| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
| Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species) |
| Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry) |
| Domain d1mpya2: 1mpy A:146-307 [38509] complexed with acn, fe2 |
PDB Entry: 1mpy (more details), 2.8 Å
SCOPe Domain Sequences for d1mpya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]}
maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih
hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne
vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt
Timeline for d1mpya2: