Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins) contains a single copy of this fold |
Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species) |
Species Escherichia coli [TaxId:562] [55954] (11 PDB entries) Uniprot P04395 |
Domain d1mpga2: 1mpg A:1-99 [41296] Other proteins in same PDB: d1mpga1, d1mpgb1 complexed with gol |
PDB Entry: 1mpg (more details), 1.8 Å
SCOPe Domain Sequences for d1mpga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpga2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg
Timeline for d1mpga2: