Lineage for d1mosa_ (1mos A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387552Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1387553Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1387554Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 1387555Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 1387556Species Escherichia coli [TaxId:562] [53700] (8 PDB entries)
  8. 1387562Domain d1mosa_: 1mos A: [35304]
    complexed with agp, mes, na, so4

Details for d1mosa_

PDB Entry: 1mos (more details), 2 Å

PDB Description: isomerase domain of glucosamine 6-phosphate synthase complexed with 2-amino-2-deoxyglucitol 6-phosphate
PDB Compounds: (A:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1mosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mosa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
agdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacg
tsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrl
skelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsr
lkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypiale
galklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrargg
qlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnl
aksvtve

SCOPe Domain Coordinates for d1mosa_:

Click to download the PDB-style file with coordinates for d1mosa_.
(The format of our PDB-style files is described here.)

Timeline for d1mosa_: