Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
Protein Flavin-binding protein dodecin [89809] (1 species) |
Species Halobacterium salinarum [TaxId:2242] [89810] (2 PDB entries) |
Domain d1moga_: 1mog A: [85034] complexed with cl, mg, na, rbf |
PDB Entry: 1mog (more details), 1.7 Å
SCOPe Domain Sequences for d1moga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1moga_ d.230.2.1 (A:) Flavin-binding protein dodecin {Halobacterium salinarum [TaxId: 2242]} vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva feldgsq
Timeline for d1moga_: