Lineage for d1mo9a3 (1mo9 A:384-523)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)
  7. Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries)
  8. Domain d1mo9a3: 1mo9 A:384-523 [79343]
    Other proteins in same PDB: d1mo9a1, d1mo9a2, d1mo9b1, d1mo9b2
    complexed with fad, kpc

Details for d1mo9a3

PDB Entry: 1mo9 (more details), 1.65 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase complexed with 2-ketopropyl coenzyme m
PDB Compounds: (A:) orf3

SCOPe Domain Sequences for d1mo9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

SCOPe Domain Coordinates for d1mo9a3 are not available.

Timeline for d1mo9a3:

Domains from same chain:
(mouse over for more information)
d1mo9a1, d1mo9a2
Domains from other chains:
(mouse over for more information)
d1mo9b1, d1mo9b2, d1mo9b3