Class a: All alpha proteins [46456] (284 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins) |
Protein Mnt repressor [47602] (1 species) |
Species Salmonella bacteriophage P22 [TaxId:10754] [47603] (1 PDB entry) |
Domain d1mnta_: 1mnt A: [17453] includes 15 residues common with the tetramerization domain |
PDB Entry: 1mnt (more details)
SCOP Domain Sequences for d1mnta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnta_ a.43.1.1 (A:) Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]} arddphfnfrmpmevreklkfraeangrsmnsellqivqdalskpspvtgyrndaerlad eqselv
Timeline for d1mnta_: