Lineage for d1mnta_ (1mnt A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.43.1: Ribbon-helix-helix [47598] (11 families) 
formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins) 
Protein Mnt repressor [47602] (1 species) Species Salmonella bacteriophage P22 [TaxId:10754] [47603] (1 PDB entry) 
Domain d1mnta_: 1mnt A: [17453]
includes 15 residues common with the tetramerization domain
Details for d1mnta_
PDB Entry: 1mnt (more details)
PDB Description: solution structure of dimeric mnt repressor (1-76)
PDB Compounds: (A:) mnt repressorSCOP Domain Sequences for d1mnta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnta_ a.43.1.1 (A:) Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
arddphfnfrmpmevreklkfraeangrsmnsellqivqdalskpspvtgyrndaerlad
eqselv
SCOP Domain Coordinates for d1mnta_:
Click to download the PDB-style file with coordinates for d1mnta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mnta_:
- d1mnta_ first appeared (with stable ids) in SCOP 1.55
- d1mnta_ appears in SCOP 1.73
- d1mnta_ appears in SCOPe 2.01
- d1mnta_ appears in the current release, SCOPe 2.08
View in 3D
