Lineage for d1mnga2 (1mng A:93-203)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411455Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1411585Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 1411710Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries)
  8. 1411711Domain d1mnga2: 1mng A:93-203 [38701]
    Other proteins in same PDB: d1mnga1, d1mngb1
    complexed with azi, mn

Details for d1mnga2

PDB Entry: 1mng (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1mnga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka

SCOPe Domain Coordinates for d1mnga2:

Click to download the PDB-style file with coordinates for d1mnga2.
(The format of our PDB-style files is described here.)

Timeline for d1mnga2:

1411711
d1mnga2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1mnga1