Lineage for d1mnga2 (1mng A:93-203)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) 
Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries) 
Domain d1mnga2: 1mng A:93-203 [38701]
Other proteins in same PDB: d1mnga1, d1mngb1
complexed with azi, mn
Details for d1mnga2
PDB Entry: 1mng (more details), 1.8 Å
PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (A:) manganese superoxide dismutaseSCOPe Domain Sequences for d1mnga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka
SCOPe Domain Coordinates for d1mnga2:
Click to download the PDB-style file with coordinates for d1mnga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mnga2:
- d1mnga2 first appeared (with stable ids) in SCOP 1.55
- d1mnga2 appears in SCOPe 2.07
View in 3D
