![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [54750] (2 PDB entries) |
![]() | Domain d1mmsa2: 1mms A:8-70 [38766] Other proteins in same PDB: d1mmsa1, d1mmsb_ protein/RNA complex; complexed with cd, mg, mmc |
PDB Entry: 1mms (more details), 2.57 Å
SCOPe Domain Sequences for d1mmsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft fii
Timeline for d1mmsa2: