Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Thermotoga maritima [TaxId:2336] [46910] (1 PDB entry) |
Domain d1mmsa1: 1mms A:71-140 [16247] Other proteins in same PDB: d1mmsa2 protein/RNA complex; complexed with cd, mg, mmc |
PDB Entry: 1mms (more details), 2.57 Å
SCOPe Domain Sequences for d1mmsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg taksmgievv
Timeline for d1mmsa1: