Lineage for d1mmsa1 (1mms A:71-140)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) 
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) 
Species Thermotoga maritima [TaxId:2336] [46910] (5 PDB entries) 
Domain d1mmsa1: 1mms A:71-140 [16247]
Other proteins in same PDB: d1mmsa2
protein/RNA complex; complexed with cd, mg, mmc; mutant
Details for d1mmsa1
PDB Entry: 1mms (more details), 2.57 Å
PDB Description: crystal structure of the ribosomal protein l11-rna complex
PDB Compounds: (A:) protein (ribosomal protein l11)SCOP Domain Sequences for d1mmsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv
SCOP Domain Coordinates for d1mmsa1:
Click to download the PDB-style file with coordinates for d1mmsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mmsa1:
- d1mmsa1 first appeared (with stable ids) in SCOP 1.55
- d1mmsa1 appears in SCOP 1.73
- d1mmsa1 appears in SCOPe 2.01
- d1mmsa1 appears in the current release, SCOPe 2.08
View in 3D
