Lineage for d1mmsa1 (1mms A:71-140)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763259Species Thermotoga maritima [TaxId:2336] [46910] (5 PDB entries)
  8. 763260Domain d1mmsa1: 1mms A:71-140 [16247]
    Other proteins in same PDB: d1mmsa2
    protein/RNA complex; complexed with cd, mg, mmc; mutant

Details for d1mmsa1

PDB Entry: 1mms (more details), 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex
PDB Compounds: (A:) protein (ribosomal protein l11)

SCOP Domain Sequences for d1mmsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOP Domain Coordinates for d1mmsa1:

Click to download the PDB-style file with coordinates for d1mmsa1.
(The format of our PDB-style files is described here.)

Timeline for d1mmsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mmsb_