Lineage for d1mm9a_ (1mm9 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552700Protein Streptavidin [50878] (1 species)
  7. 1552701Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)
  8. 1552977Domain d1mm9a_: 1mm9 A: [85017]
    mutant with insertion of fibronectin hexapeptide, including rgd
    complexed with mrd; mutant

Details for d1mm9a_

PDB Entry: 1mm9 (more details), 1.66 Å

PDB Description: Streptavidin Mutant with Insertion of Fibronectin Hexapeptide, including RGD
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1mm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm9a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapgrgdspgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaas

SCOPe Domain Coordinates for d1mm9a_:

Click to download the PDB-style file with coordinates for d1mm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm9a_: