Lineage for d1mm6a_ (1mm6 A:)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) 
Protein Glutamate receptor ligand binding core [53881] (4 species) Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries) 
Domain d1mm6a_: 1mm6 A: [79296]
Details for d1mm6a_
PDB Entry: 1mm6 (more details), 2.15 Å
PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with quisqualate in a non zinc crystal form at 2.15 angstroms resolution
PDB Compounds: (A:) Glutamate receptor 2SCOP Domain Sequences for d1mm6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mm6a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
anktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkl
neqglldklknkwwydkgecg
SCOP Domain Coordinates for d1mm6a_:
Click to download the PDB-style file with coordinates for d1mm6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mm6a_:
- d1mm6a_ first appeared in SCOP 1.63
- d1mm6a_ appears in SCOP 1.71
- d1mm6a_ appears in SCOP 1.75
- d1mm6a_ appears in the current release, SCOPe 2.08, called d1mm6a1
View in 3D
