Lineage for d1ml4a1 (1ml4 A:2-151)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) Species Pyrococcus abyssi [TaxId:29292] [82533] (1 PDB entry) 
Domain d1ml4a1: 1ml4 A:2-151 [79255]
complexed with pal
Details for d1ml4a1
PDB Entry: 1ml4 (more details), 1.8 Å
PDB Description: The PALA-liganded Aspartate transcarbamoylase catalytic subunit from Pyrococcus abyssi
PDB Compounds: (A:) aspartate transcarbamoylaseSCOPe Domain Sequences for d1ml4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml4a1 c.78.1.1 (A:2-151) Aspartate carbamoyltransferase catalytic subunit {Pyrococcus abyssi [TaxId: 29292]}
dwkgrdvisirdfskedietvlataerlerelkekgqleyakgkilatlffepstrtrls
fesamhrlggavigfaeastssvkkgeslrdtiktveqycdvivirhpkegaarlaaeva
evpvinagdgsnqhptqtlldlytikkefg
SCOPe Domain Coordinates for d1ml4a1:
Click to download the PDB-style file with coordinates for d1ml4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ml4a1:
- d1ml4a1 first appeared in SCOP 1.63
- d1ml4a1 appears in SCOPe 2.07
View in 3D
