Lineage for d1mkda_ (1mkd A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780317Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 780318Species Human (Homo sapiens) [TaxId:9606] [89152] (22 PDB entries)
    Uniprot Q08499 388-713
  8. 780370Domain d1mkda_: 1mkd A: [84982]

Details for d1mkda_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex
PDB Compounds: (A:) Phosphodiesterase 4D

SCOP Domain Sequences for d1mkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkda_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOP Domain Coordinates for d1mkda_:

Click to download the PDB-style file with coordinates for d1mkda_.
(The format of our PDB-style files is described here.)

Timeline for d1mkda_: