Lineage for d1mjia_ (1mji A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.77: RL5-like [55281] (1 superfamily)
beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654Superfamily d.77.1: RL5-like [55282] (3 families) 
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) Protein Ribosomal protein L5 [55284] (5 species)
synonym: 50S ribosomal protein L5p, HMAL5, HL13
Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries) 
Domain d1mjia_: 1mji A: [79208]
complex with a 5S rRNA fragment
protein/RNA complex; complexed with k, mg
Details for d1mjia_
PDB Entry: 1mji (more details), 2.5 Å
PDB Description: detailed analysis of rna-protein interactions within the bacterial ribosomal protein l5/5s rrna complex
PDB Compounds: (A:) 50S ribosomal protein L5SCOPe Domain Sequences for d1mjia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjia_ d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
SCOPe Domain Coordinates for d1mjia_:
Click to download the PDB-style file with coordinates for d1mjia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mjia_:
- d1mjia_ first appeared in SCOP 1.63
- d1mjia_ appears in SCOP 1.75
- d1mjia_ appears in SCOPe 2.02
- d1mjia_ appears in the current release, SCOPe 2.08
View in 3D
