Lineage for d1mila_ (1mil A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206801Protein Shc adaptor protein [55567] (1 species)
  7. 2206802Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries)
  8. 2206803Domain d1mila_: 1mil A: [40496]

Details for d1mila_

PDB Entry: 1mil (more details), 2.7 Å

PDB Description: transforming protein
PDB Compounds: (A:) shc adaptor protein

SCOPe Domain Sequences for d1mila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
gsqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltglqsgqpkhlllvdpe
gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverkl

SCOPe Domain Coordinates for d1mila_:

Click to download the PDB-style file with coordinates for d1mila_.
(The format of our PDB-style files is described here.)

Timeline for d1mila_: