SCOPe 2.03: Domain d1mi5d1: 1mi5 D:2-117

Lineage for d1mi5d1 (1mi5 D:2-117)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
Domain d1mi5d1: 1mi5 D:2-117 [79145]
Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d2, d1mi5e2
LC13 clone

Details for d1mi5d1

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d1mi5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5d1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
kttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmasl
aiaedrksstlilhratlrdaavyycilplaggtsygkltfgqgtiltvhpn

SCOPe Domain Coordinates for d1mi5d1:

Click to download the PDB-style file with coordinates for d1mi5d1.
(The format of our PDB-style files is described here.)

Timeline for d1mi5d1: