Lineage for d1mi3a_ (1mi3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. Protein Xylose reductase [75058] (1 species)
  7. Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. Domain d1mi3a_: 1mi3 A: [91274]
    complexed with nad

Details for d1mi3a_

PDB Entry: 1mi3 (more details), 1.8 Å

PDB Description: 1.8 Angstrom structure of xylose reductase from Candida tenuis in complex with NAD
PDB Compounds: (A:) xylose reductase

SCOPe Domain Sequences for d1mi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1mi3a_ are not available.

Timeline for d1mi3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mi3b_, d1mi3c_, d1mi3d_