Lineage for d1mgpa_ (1mgp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884965Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 1884966Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 1884967Family c.119.1.1: DegV-like [82550] (2 proteins)
    Pfam PF02645, DUF194
  6. 1884972Protein Hypothetical protein TM841 [82551] (1 species)
    reveals fatty acid binding function
  7. 1884973Species Thermotoga maritima [TaxId:2336] [82552] (2 PDB entries)
    Uniprot Q9X1H9
  8. 1884974Domain d1mgpa_: 1mgp A: [79098]
    structural genomics
    complexed with plm

Details for d1mgpa_

PDB Entry: 1mgp (more details), 2 Å

PDB Description: Hypothetical protein TM841 from Thermotoga maritima reveals fatty acid binding function
PDB Compounds: (A:) Hypothetical protein TM841

SCOPe Domain Sequences for d1mgpa_:

Sequence, based on SEQRES records: (download)

>d1mgpa_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
hmkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireags
vpktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtl
lasgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvskf
qgfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadn
eagvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievl

Sequence, based on observed residues (ATOM records): (download)

>d1mgpa_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
hmkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireags
vpktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtl
lasgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvllk
irvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvvelln
tlrksyevvdeiispmgkvitthvgpgtvgfgievl

SCOPe Domain Coordinates for d1mgpa_:

Click to download the PDB-style file with coordinates for d1mgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1mgpa_: