Lineage for d1mg4a_ (1mg4 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854885Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 854886Family d.15.11.1: Doublecortin (DC) [89838] (2 proteins)
  6. 854890Protein Doublecortin-like kinase Dclk [89839] (1 species)
    KIAA0369; duplication: contains tandem repeat of two DC domains
  7. 854891Species Human (Homo sapiens) [TaxId:9606] [89840] (3 PDB entries)
  8. 854892Domain d1mg4a_: 1mg4 A: [84953]
    N-terminal DC domain
    complexed with sul

Details for d1mg4a_

PDB Entry: 1mg4 (more details), 1.5 Å

PDB Description: structure of n-terminal doublecortin domain from dclk: wild type protein
PDB Compounds: (A:) doublecortin-like kinase (n-terminal domain)

SCOP Domain Sequences for d1mg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg4a_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]}
kkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrtiytidg
lkkissldqlvegesyvcgsiepfkkleytknvnpnwsvnv

SCOP Domain Coordinates for d1mg4a_:

Click to download the PDB-style file with coordinates for d1mg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mg4a_: