| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) ![]() possibly related to the ubiquitin-like superfamily |
| Family d.15.11.1: Doublecortin (DC) [89838] (2 proteins) |
| Protein Doublecortin-like kinase Dclk [89839] (1 species) KIAA0369; duplication: contains tandem repeat of two DC domains |
| Species Human (Homo sapiens) [TaxId:9606] [89840] (3 PDB entries) |
| Domain d1mg4a_: 1mg4 A: [84953] N-terminal DC domain complexed with sul |
PDB Entry: 1mg4 (more details), 1.5 Å
SCOP Domain Sequences for d1mg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg4a_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]}
kkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrtiytidg
lkkissldqlvegesyvcgsiepfkkleytknvnpnwsvnv
Timeline for d1mg4a_: