Class a: All alpha proteins [46456] (286 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c551 [46660] (5 species) |
Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries) |
Domain d1mg2d_: 1mg2 D: [79062] Other proteins in same PDB: d1mg2a_, d1mg2b_, d1mg2c_, d1mg2e_, d1mg2f_, d1mg2g_, d1mg2i_, d1mg2j_, d1mg2k_, d1mg2m_, d1mg2n_, d1mg2o_ complexed with cu, hem, na, po4; mutant |
PDB Entry: 1mg2 (more details), 2.25 Å
SCOPe Domain Sequences for d1mg2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg2d_ a.3.1.1 (D:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]} apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv rhlytgdpkdaswltdeqkagftpfqp
Timeline for d1mg2d_: