Lineage for d1mg2d_ (1mg2 D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633884Protein Cytochrome c551 [46660] (4 species)
  7. 633887Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 633897Domain d1mg2d_: 1mg2 D: [79062]
    Other proteins in same PDB: d1mg2a_, d1mg2b_, d1mg2c_, d1mg2e_, d1mg2f_, d1mg2g_, d1mg2i_, d1mg2j_, d1mg2k_, d1mg2m_, d1mg2n_, d1mg2o_

Details for d1mg2d_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (D:) cytochrome c-l

SCOP Domain Sequences for d1mg2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2d_ a.3.1.1 (D:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d1mg2d_:

Click to download the PDB-style file with coordinates for d1mg2d_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2d_: