Lineage for d1mfwa_ (1mfw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935111Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2935112Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)
  6. 2935116Protein Doublecortin-like kinase Dclk [89839] (1 species)
    KIAA0369; duplication: contains tandem repeat of two DC domains
  7. 2935117Species Human (Homo sapiens) [TaxId:9606] [89840] (3 PDB entries)
  8. 2935119Domain d1mfwa_: 1mfw A: [84940]
    N-terminal DC domain
    complexed with so4

Details for d1mfwa_

PDB Entry: 1mfw (more details), 1.6 Å

PDB Description: structure of n-terminal doublecortin domain from dclk: selenomethionine labeled protein
PDB Compounds: (A:) doublecortin-like kinase (n-terminal domain)

SCOPe Domain Sequences for d1mfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfwa_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]}
tlssekkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrti
ytidglkkissmdqlvegesyvcgsiepfkkleytknvnpnwsvnv

SCOPe Domain Coordinates for d1mfwa_:

Click to download the PDB-style file with coordinates for d1mfwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mfwa_: