![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) ![]() possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins) |
![]() | Protein Doublecortin-like kinase Dclk [89839] (1 species) KIAA0369; duplication: contains tandem repeat of two DC domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89840] (3 PDB entries) |
![]() | Domain d1mfwa_: 1mfw A: [84940] N-terminal DC domain complexed with so4 |
PDB Entry: 1mfw (more details), 1.6 Å
SCOPe Domain Sequences for d1mfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfwa_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]} tlssekkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvrti ytidglkkissmdqlvegesyvcgsiepfkkleytknvnpnwsvnv
Timeline for d1mfwa_: