Lineage for d1mfqc_ (1mfq C:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
4 helices; orthogonal arraySuperfamily a.36.1: Signal peptide-binding domain [47446] (2 families) 
Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) 
Protein SRP54M [47451] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47452] (3 PDB entries) 
Domain d1mfqc_: 1mfq C: [79046]
Other proteins in same PDB: d1mfqb_
a part of a ternary s-domain complex
protein/RNA complex; complexed with cl, mg
Details for d1mfqc_
PDB Entry: 1mfq (more details), 3.1 Å
PDB Description: Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle
PDB Compounds: (C:) signal recognition particle 54kDa proteinSCOPe Domain Sequences for d1mfqc_:
Sequence, based on SEQRES records: (download)
>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
khgqftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsm
ndqeldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik
Sequence, based on observed residues (ATOM records): (download)
>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
khgqftlrdmyeqfqnimkmgpfsqilgmipgfneqesmarlkklmtimdsmndqeldst
dgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik
SCOPe Domain Coordinates for d1mfqc_:
Click to download the PDB-style file with coordinates for d1mfqc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mfqc_:
- d1mfqc_ first appeared in SCOP 1.63
- d1mfqc_ appears in SCOPe 2.07
View in 3D
