Lineage for d1mfoa_ (1mfo A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244641Species Mycobacterium fortuitum [TaxId:1766] [56615] (2 PDB entries)
  8. 2244643Domain d1mfoa_: 1mfo A: [302741]
    automated match to d2cc1a1

Details for d1mfoa_

PDB Entry: 1mfo (more details), 2.4 Å

PDB Description: beta-lactamase from mycobacterium fortuitum
PDB Compounds: (A:) protein (beta-lactamase)

SCOPe Domain Sequences for d1mfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfoa_ e.3.1.1 (A:) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]}
apiddqlaelerrdnvliglyaanlqsgrrithrpdemfamcstfkgyvaarvlqmaehg
eisldnrvfvdadalvpnspvtearagaemtlaelcqaalqrsdntaanlllktiggpaa
vtafarsvgdertrldrwevelnsaipgdprdtstpaalavgyrailagdalsppqrgll
edwmranqtssmraglpegwttadktgsgdygstndagiafgpdgqrlllvmmtrsqahd
pkaenlrpligeltalvlpsll

SCOPe Domain Coordinates for d1mfoa_:

Click to download the PDB-style file with coordinates for d1mfoa_.
(The format of our PDB-style files is described here.)

Timeline for d1mfoa_: