Lineage for d1mfia_ (1mfi A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567390Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2567391Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2567647Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2567667Protein Microphage migration inhibition factor (MIF) [55340] (8 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2567987Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries)
  8. 2567991Domain d1mfia_: 1mfi A: [39856]
    complexed with fhc

Details for d1mfia_

PDB Entry: 1mfi (more details), 1.8 Å

PDB Description: crystal structure of macrophage migration inhibitory factor complexed with (e)-2-fluoro-p-hydroxycinnamate
PDB Compounds: (A:) protein (macrophage migration inhibitory factor)

SCOPe Domain Sequences for d1mfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfia_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]}
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

SCOPe Domain Coordinates for d1mfia_:

Click to download the PDB-style file with coordinates for d1mfia_.
(The format of our PDB-style files is described here.)

Timeline for d1mfia_: