Lineage for d1mfbh2 (1mfb H:368-468)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
Domain d1mfbh2: 1mfb H:368-468 [20985]
Other proteins in same PDB: d1mfbh1, d1mfbl1, d1mfbl2
part of Fab SE155-4
Details for d1mfbh2
PDB Entry: 1mfb (more details), 2.1 Å
PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
PDB Compounds: (H:) igg1-lambda se155-4 fab (heavy chain)SCOPe Domain Sequences for d1mfbh2:
Sequence, based on SEQRES records: (download)
>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Sequence, based on observed residues (ATOM records): (download)
>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr
SCOPe Domain Coordinates for d1mfbh2:
Click to download the PDB-style file with coordinates for d1mfbh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mfbh2:
- d1mfbh2 first appeared (with stable ids) in SCOP 1.55
- d1mfbh2 appears in SCOPe 2.02
- d1mfbh2 appears in SCOPe 2.04
- d1mfbh2 appears in the current release, SCOPe 2.08
View in 3D
