Lineage for d1mbya_ (1mby A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007581Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 3007582Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 3007583Family d.223.1.1: Swapped Polo-box domain [82616] (2 proteins)
    beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5]
  6. 3007584Protein Serine/threonine-protein kinase Sak C-terminal domain [82617] (1 species)
  7. 3007585Species Mouse (Mus musculus) [TaxId:10090] [82618] (1 PDB entry)
  8. 3007586Domain d1mbya_: 1mby A: [78931]

Details for d1mbya_

PDB Entry: 1mby (more details), 2 Å

PDB Description: murine sak polo domain
PDB Compounds: (A:) serine/threonine kinase

SCOPe Domain Sequences for d1mbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbya_ d.223.1.1 (A:) Serine/threonine-protein kinase Sak C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
svfvknvgwatqltsgavwvqfndgsqlvmqagvssisytspdgqttrygeneklpeyik
qklqllssillmfsn

SCOPe Domain Coordinates for d1mbya_:

Click to download the PDB-style file with coordinates for d1mbya_.
(The format of our PDB-style files is described here.)

Timeline for d1mbya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mbyb_