Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species) overall structure is similar to TyrRS |
Species Bacillus stearothermophilus [TaxId:1422] [52379] (13 PDB entries) |
Domain d1maua_: 1mau A: [78892] protein/RNA complex; complexed with atp, cit, gol, ltn, mg, na |
PDB Entry: 1mau (more details), 2.15 Å
SCOPe Domain Sequences for d1maua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1maua_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl degaekanrvasemvrkmeqamglgrrr
Timeline for d1maua_: