Lineage for d1mata_ (1mat A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214036Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2214037Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2214038Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2214087Protein Methionine aminopeptidase [55924] (6 species)
  7. 2214098Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2214138Domain d1mata_: 1mat A: [41152]
    complexed with co

Details for d1mata_

PDB Entry: 1mat (more details), 2.4 Å

PDB Description: structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
PDB Compounds: (A:) methionyl aminopeptidase

SCOPe Domain Sequences for d1mata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mata_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d1mata_:

Click to download the PDB-style file with coordinates for d1mata_.
(The format of our PDB-style files is described here.)

Timeline for d1mata_: