Lineage for d1mabb1 (1mab B:358-477)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643851Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 643891Species Rat (Rattus norvegicus) [TaxId:10116] [88930] (4 PDB entries)
  8. 643899Domain d1mabb1: 1mab B:358-477 [18312]
    Other proteins in same PDB: d1maba1, d1maba2, d1maba3, d1mabb2, d1mabb3, d1mabg_
    complexed with adp, atp, mg, po4

Details for d1mabb1

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase
PDB Compounds: (B:) protein (f1-ATPase beta chain)

SCOP Domain Sequences for d1mabb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mabb1 a.69.1.1 (B:358-477) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh

SCOP Domain Coordinates for d1mabb1:

Click to download the PDB-style file with coordinates for d1mabb1.
(The format of our PDB-style files is described here.)

Timeline for d1mabb1: