Lineage for d1maba3 (1mab A:95-379)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364671Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 1364720Species Norway rat (Rattus norvegicus) [TaxId:10116] [88776] (2 PDB entries)
  8. 1364721Domain d1maba3: 1mab A:95-379 [32356]
    Other proteins in same PDB: d1maba1, d1maba2, d1mabb1, d1mabb2, d1mabb3, d1mabg_
    complexed with adp, atp, mg, po4

Details for d1maba3

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase
PDB Compounds: (A:) protein (f1-ATPase alpha chain)

SCOPe Domain Sequences for d1maba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maba3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdvpvgdellgrvvdalgnaidgkgpvgskirrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndsfgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1maba3:

Click to download the PDB-style file with coordinates for d1maba3.
(The format of our PDB-style files is described here.)

Timeline for d1maba3: