Lineage for d1m8wb_ (1m8w B:)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (24 families) 
Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
Protein Pumilio 1 [63612] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63613] (12 PDB entries) 
Domain d1m8wb_: 1m8w B: [78829]
protein/RNA complex
Details for d1m8wb_
PDB Entry: 1m8w (more details), 2.2 Å
PDB Description: crystal structure of the pumilio-homology domain from human pumilio1 in complex with nre1-19 rna
PDB Compounds: (B:) pumilio 1SCOPe Domain Sequences for d1m8wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8wb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy
SCOPe Domain Coordinates for d1m8wb_:
Click to download the PDB-style file with coordinates for d1m8wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m8wb_:
- d1m8wb_ first appeared in SCOP 1.63
- d1m8wb_ appears in SCOP 1.75
- d1m8wb_ appears in SCOPe 2.02
- d1m8wb_ appears in the current release, SCOPe 2.08
View in 3D
