Lineage for d1m8na_ (1m8n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2814442Superfamily b.81.2: An insect antifreeze protein [51177] (1 family) (S)
    superhelical turns are made of three short strands
  5. 2814443Family b.81.2.1: An insect antifreeze protein [51178] (2 proteins)
    this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain
  6. 2814444Protein Thermal hysteresis protein [51179] (2 species)
    there are different numbers of superhelical turns (and sequence repeats) in different isoforms
  7. 2814452Species Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId:7141] [88690] (1 PDB entry)
  8. 2814453Domain d1m8na_: 1m8n A: [78771]
    isoform 501

Details for d1m8na_

PDB Entry: 1m8n (more details), 2.45 Å

PDB Description: choristoneura fumiferana (spruce budworm) antifreeze protein isoform 501
PDB Compounds: (A:) Antifreeze protein isoform 501

SCOPe Domain Sequences for d1m8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8na_ b.81.2.1 (A:) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId: 7141]}
gtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidks
qvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsam

SCOPe Domain Coordinates for d1m8na_:

Click to download the PDB-style file with coordinates for d1m8na_.
(The format of our PDB-style files is described here.)

Timeline for d1m8na_: