Lineage for d1m6ta_ (1m6t A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. Protein Cytochrome b562 [47177] (1 species)
  7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. Domain d1m6ta_: 1m6t A: [78705]
    b562ril, a redesigned four helix bundle
    complexed with so4

Details for d1m6ta_

PDB Entry: 1m6t (more details), 1.81 Å

PDB Description: crystal structure of b562ril, a redesigned four helix bundle
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d1m6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ta_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl

SCOPe Domain Coordinates for d1m6ta_ are not available.

Timeline for d1m6ta_: