Lineage for d1m6oa2 (1m6o A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856525Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
    Uniprot P30481 25-300
  8. 856527Domain d1m6oa2: 1m6o A:1-181 [91190]
    Other proteins in same PDB: d1m6oa1, d1m6ob_

Details for d1m6oa2

PDB Entry: 1m6o (more details), 1.6 Å

PDB Description: Crystal Structure of HLA B*4402 in complex with HLA DPA*0201 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-44(B-12) B*4402 alpha chain

SCOP Domain Sequences for d1m6oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6oa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

SCOP Domain Coordinates for d1m6oa2:

Click to download the PDB-style file with coordinates for d1m6oa2.
(The format of our PDB-style files is described here.)

Timeline for d1m6oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m6oa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1m6ob_