Lineage for d1m6ex_ (1m6e X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501659Family c.66.1.35: Salicylic acid carboxyl methyltransferase (SAMT) [102563] (1 protein)
    automatically mapped to Pfam PF03492
  6. 2501660Protein Salicylic acid carboxyl methyltransferase (SAMT) [102564] (1 species)
  7. 2501661Species Clarkia breweri [TaxId:36903] [102565] (1 PDB entry)
  8. 2501662Domain d1m6ex_: 1m6e X: [91188]
    complexed with lu, sah, sal

Details for d1m6ex_

PDB Entry: 1m6e (more details), 3 Å

PDB Description: crystal structure of salicylic acid carboxyl methyltransferase (samt)
PDB Compounds: (X:) S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase

SCOPe Domain Sequences for d1m6ex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]}
mdvrqvlhmkggagensyamnsfiqrqvisitkpiteaaitalysgdtvttrlaiadlgc
ssgpnalfavteliktveelrkkmgrenspeyqiflndlpgndfnaifrslpiendvdgv
cfingvpgsfygrlfprntlhfihssyslmwlsqvpigiesnkgniymantcpqsvlnay
ykqfqedhalflrcraqevvpggrmvltilgrrsedrasteccliwqllamalnqmvseg
lieeekmdkfnipqytpspteveaeilkegsflidhieaseiywssctkdgdgggsveee
gynvarcmravaepllldhfgeaiiedvfhryklliiermskektkfinvivslirksd

SCOPe Domain Coordinates for d1m6ex_:

Click to download the PDB-style file with coordinates for d1m6ex_.
(The format of our PDB-style files is described here.)

Timeline for d1m6ex_: