Lineage for d1m52a_ (1m52 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries) 
Domain d1m52a_: 1m52 A: [78634]
complexed with mes, p17
Details for d1m52a_
PDB Entry: 1m52 (more details), 2.6 Å
PDB Description: Crystal Structure of the c-Abl Kinase domain in complex with PD173955
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1SCOPe Domain Sequences for d1m52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m52a_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessi
SCOPe Domain Coordinates for d1m52a_:
Click to download the PDB-style file with coordinates for d1m52a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m52a_:
- d1m52a_ first appeared in SCOP 1.63
- d1m52a_ appears in SCOPe 2.06
- d1m52a_ appears in the current release, SCOPe 2.08
View in 3D
