Lineage for d1m4ra_ (1m4r A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266633Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1266703Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 1266704Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)
  8. 1266706Domain d1m4ra_: 1m4r A: [84799]

Details for d1m4ra_

PDB Entry: 1m4r (more details), 2 Å

PDB Description: crystal structure of recombinant human interleukin-22
PDB Compounds: (A:) Interleukin-22

SCOPe Domain Sequences for d1m4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ra_ a.26.1.3 (A:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci

SCOPe Domain Coordinates for d1m4ra_:

Click to download the PDB-style file with coordinates for d1m4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m4rb_