Lineage for d1m4ra_ (1m4r A:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily)
core: 4 helices; bundle, closed; left-handed twist; 2 crossover connectionsSuperfamily a.26.1: 4-helical cytokines [47266] (3 families) 
there are two different topoisomers of this fold with different entanglements of the two crossover connectionsFamily a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
contains an additional helix in one of the crossover connections
Protein Interleukin-22 (IL-22) [89036] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89037] (2 PDB entries) 
Domain d1m4ra_: 1m4r A: [84799]
Details for d1m4ra_
PDB Entry: 1m4r (more details), 2 Å
PDB Description: crystal structure of recombinant human interleukin-22
PDB Compounds: (A:) Interleukin-22SCOP Domain Sequences for d1m4ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ra_ a.26.1.3 (A:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci
SCOP Domain Coordinates for d1m4ra_:
Click to download the PDB-style file with coordinates for d1m4ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m4ra_:
- d1m4ra_ first appeared in SCOP 1.65
- d1m4ra_ appears in SCOP 1.71
- d1m4ra_ appears in SCOP 1.75
- d1m4ra_ appears in the current release, SCOPe 2.08
View in 3D
