Lineage for d1m4oa_ (1m4o A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567257Superfamily b.82.1: RmlC-like cupins [51182] (16 families) (S)
  5. 567435Family b.82.1.6: Acireductone dioxygenase [82191] (1 protein)
  6. 567436Protein Acireductone dioxygenase [82192] (1 species)
  7. 567437Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry)
  8. 567438Domain d1m4oa_: 1m4o A: [78606]
    NMR-derived model
    complexed with ni2

Details for d1m4oa_

PDB Entry: 1m4o (more details)

PDB Description: nmr-derived model for the solution structure of nickel-containing acireductone dioxygenase from klebsiella

SCOP Domain Sequences for d1m4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4oa_ b.82.1.6 (A:) Acireductone dioxygenase {Klebsiella pneumoniae}
saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla

SCOP Domain Coordinates for d1m4oa_:

Click to download the PDB-style file with coordinates for d1m4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1m4oa_: