Class b: All beta proteins [48724] (149 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (16 families) |
Family b.82.1.6: Acireductone dioxygenase [82191] (1 protein) |
Protein Acireductone dioxygenase [82192] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry) |
Domain d1m4oa_: 1m4o A: [78606] NMR-derived model complexed with ni2 |
PDB Entry: 1m4o (more details)
SCOP Domain Sequences for d1m4oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4oa_ b.82.1.6 (A:) Acireductone dioxygenase {Klebsiella pneumoniae} saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla
Timeline for d1m4oa_: