Lineage for d1m3qa2 (1m3q A:9-135)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alpha
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) 
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
contains a single copy of this fold
Protein 8-oxoguanine glycosylase [55955] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) 
Domain d1m3qa2: 1m3q A:9-135 [91185]
Other proteins in same PDB: d1m3qa1
protein/DNA complex; complexed with ang, ca; mutant
Details for d1m3qa2
PDB Entry: 1m3q (more details), 1.9 Å
PDB Description: crystal structure of hogg1 d268e mutant with base-excised dna and 8- aminoguanine
PDB Compounds: (A:) 8-oxoguanine DNA glycosylaseSCOPe Domain Sequences for d1m3qa2:
Sequence, based on SEQRES records: (download)
>d1m3qa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq
Sequence, based on observed residues (ATOM records): (download)
>d1m3qa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq
SCOPe Domain Coordinates for d1m3qa2:
Click to download the PDB-style file with coordinates for d1m3qa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m3qa2:
- d1m3qa2 first appeared in SCOP 1.67
- d1m3qa2 appears in SCOPe 2.02
- d1m3qa2 appears in SCOPe 2.04
- d1m3qa2 appears in the current release, SCOPe 2.08
View in 3D
