Lineage for d1m3qa2 (1m3q A:9-135)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431003Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1431115Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 1431156Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 1431157Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 1431158Domain d1m3qa2: 1m3q A:9-135 [91185]
    Other proteins in same PDB: d1m3qa1
    protein/DNA complex; complexed with ang, ca; mutant

Details for d1m3qa2

PDB Entry: 1m3q (more details), 1.9 Å

PDB Description: crystal structure of hogg1 d268e mutant with base-excised dna and 8- aminoguanine
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1m3qa2:

Sequence, based on SEQRES records: (download)

>d1m3qa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d1m3qa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOPe Domain Coordinates for d1m3qa2:

Click to download the PDB-style file with coordinates for d1m3qa2.
(The format of our PDB-style files is described here.)

Timeline for d1m3qa2: