SCOP 1.75: Domain d1m3eb2: 1m3e B:259-481

Lineage for d1m3eb2 (1m3e B:259-481)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families)

Family c.124.1.3: CoA transferase beta subunit-like [74657] (3 proteins)
catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
Species Pig (Sus scrofa) [TaxId:9823] [82467] (7 PDB entries)
Domain d1m3eb2: 1m3e B:259-481 [78560]
Other proteins in same PDB: d1m3ea1, d1m3eb1, d1m3ec1, d1m3ed1

Details for d1m3eb2

PDB Entry: 1m3e (more details), 2.5 Å

PDB Description: succinyl-coa:3-ketoacid coa transferase from pig heart (selenomethionine)

PDB Compounds: (B:) succinyl-coa:3-ketoacid-coenzyme a transferase

SCOP Domain Sequences for d1m3eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3eb2 c.124.1.3 (B:259-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
gdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqn
evdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipg
klvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfd
vdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1m3eb2:

Click to download the PDB-style file with coordinates for d1m3eb2.
(The format of our PDB-style files is described here.)

Timeline for d1m3eb2: