SCOPe 2.08: Domain d1m3df1: 1m3d F:4-114

Lineage for d1m3df1 (1m3d F:4-114)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual fold
Superfamily d.169.1: C-type lectin-like [56436] (9 families)

Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
automatically mapped to Pfam PF01413

Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
Uniprot P02462 1445-1667
Domain d1m3df1: 1m3d F:4-114 [78543]
alpha 1 (chains A,B,D,E,G,H,J and K) and alpha 2 (chains C,F,I and L) isoforms
complexed with br, gol, lu

Details for d1m3df1

PDB Entry: 1m3d (more details), 2 Å

PDB Description: Structure of Type IV Collagen NC1 Domains

PDB Compounds: (F:) Type IV Collagen Noncollagenous Domain- Alpha2

SCOPe Domain Sequences for d1m3df1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3df1 d.169.1.6 (F:4-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
gyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpfly
cnpgdvcyyasrndksywlsttaplpmmpvaeedirpyisrcsvceapava

SCOPe Domain Coordinates for d1m3df1:

Click to download the PDB-style file with coordinates for d1m3df1.
(The format of our PDB-style files is described here.)

Timeline for d1m3df1: