Lineage for d1m33a_ (1m33 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870801Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 1870802Protein Biotin biosynthesis protein BioH [82510] (1 species)
  7. 1870803Species Escherichia coli [TaxId:562] [82511] (1 PDB entry)
  8. 1870804Domain d1m33a_: 1m33 A: [78514]
    CASP5
    complexed with 3oh, edo

Details for d1m33a_

PDB Entry: 1m33 (more details), 1.7 Å

PDB Description: crystal structure of bioh at 1.7 a
PDB Compounds: (A:) BioH protein

SCOPe Domain Sequences for d1m33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}
niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
dmaeavlqqapdkaiwlgwslgglvasqialthpervralvtvasspcfsardewpgikp
dvlagfqqqlsddqqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
aefchllvalkqrvgs

SCOPe Domain Coordinates for d1m33a_:

Click to download the PDB-style file with coordinates for d1m33a_.
(The format of our PDB-style files is described here.)

Timeline for d1m33a_: