| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
| Protein Biotin biosynthesis protein BioH [82510] (1 species) |
| Species Escherichia coli [TaxId:562] [82511] (1 PDB entry) |
| Domain d1m33a_: 1m33 A: [78514] CASP5 complexed with 3oh, edo |
PDB Entry: 1m33 (more details), 1.7 Å
SCOPe Domain Sequences for d1m33a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}
niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
dmaeavlqqapdkaiwlgwslgglvasqialthpervralvtvasspcfsardewpgikp
dvlagfqqqlsddqqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
aefchllvalkqrvgs
Timeline for d1m33a_: