Lineage for d1m2ob_ (1m2o B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476031Protein SAR1 [69483] (3 species)
  7. 2476032Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (2 PDB entries)
  8. 2476033Domain d1m2ob_: 1m2o B: [78485]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5
    complexed with sec23
    complexed with gnp, mg, zn

Details for d1m2ob_

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (B:) GTP-binding protein SAR1

SCOPe Domain Sequences for d1m2ob_:

Sequence, based on SEQRES records: (download)

>d1m2ob_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsqyi

Sequence, based on observed residues (ATOM records): (download)

>d1m2ob_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgiegqrpvevfmcsvvmrngyleafqwlsqyi

SCOPe Domain Coordinates for d1m2ob_:

Click to download the PDB-style file with coordinates for d1m2ob_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ob_: