Lineage for d1m2oa3 (1m2o A:120-390)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839328Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 839329Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 839447Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 proteins)
  6. 839448Protein Sec23 [82459] (1 species)
  7. 839449Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82460] (3 PDB entries)
  8. 839451Domain d1m2oa3: 1m2o A:120-390 [78482]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc4, d1m2oc5, d1m2od_

Details for d1m2oa3

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (A:) protein transport protein SEC23

SCOP Domain Sequences for d1m2oa3:

Sequence, based on SEQRES records: (download)

>d1m2oa3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkptgpggaashlpnamnkvtpfslnrfflpleqvefkln
qllenlspdqwsvpaghrplratgsalniaslllqgcyknipariilfasgpgtvapgli
vnselkdplrshhdidsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemk
qltdstggvllltdafstaifkqsylrlfak

Sequence, based on observed residues (ATOM records): (download)

>d1m2oa3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkptvtpfslnrfflpleqvefklnqllenlspdqwsvpa
ghrplratgsalniaslllqgcyknipariilfasgpgtvapglivnselkdplrshhdi
dsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemkqltdstggvllltda
fstaifkqsylrlfak

SCOP Domain Coordinates for d1m2oa3:

Click to download the PDB-style file with coordinates for d1m2oa3.
(The format of our PDB-style files is described here.)

Timeline for d1m2oa3: