Lineage for d1m0za_ (1m0z A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
Superfamily c.10.2: L domain-like [52058] (9 families) 
less regular structure consisting of variable repeatsFamily c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries) 
Domain d1m0za_: 1m0z A: [74359]
Details for d1m0za_
PDB Entry: 1m0z (more details), 1.85 Å
PDB Description: crystal structure of the von willebrand factor binding domain of glycoprotein ib alpha
PDB Compounds: (A:) Glycoprotein Ib alphaSCOPe Domain Sequences for d1m0za_:
Sequence, based on SEQRES records: (download)
>d1m0za_ c.10.2.7 (A:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcpt
Sequence, based on observed residues (ATOM records): (download)
>d1m0za_ c.10.2.7 (A:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskhlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltqlnld
rceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalrgl
gelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllqens
lytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvmtsnvasvq
cdnsdkfpvykypgkgcpt
SCOPe Domain Coordinates for d1m0za_:
Click to download the PDB-style file with coordinates for d1m0za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m0za_:
- d1m0za_ first appeared in SCOP 1.61
- d1m0za_ appears in SCOPe 2.04
- d1m0za_ appears in SCOPe 2.06
- d1m0za_ appears in the current release, SCOPe 2.08
View in 3D
