Lineage for d1m0ua1 (1m0u A:123-249)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270996Protein Class sigma GST [81351] (5 species)
  7. 1270997Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81771] (1 PDB entry)
  8. 1270998Domain d1m0ua1: 1m0u A:123-249 [78359]
    Other proteins in same PDB: d1m0ua2, d1m0ub2
    complexed with gsh, so4

Details for d1m0ua1

PDB Entry: 1m0u (more details), 1.75 Å

PDB Description: Crystal Structure of the Drosophila Glutathione S-transferase-2 in Complex with Glutathione
PDB Compounds: (A:) GST2 gene product

SCOPe Domain Sequences for d1m0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lcgatpwedlqidivvdtindfrlkiavvsyepedeikekklvtlnaevipfylekleqt
vkdndghlalgkltwadvyfagitdymnymvkrdllepypalrgvvdavnalepikawie
krpvtev

SCOPe Domain Coordinates for d1m0ua1:

Click to download the PDB-style file with coordinates for d1m0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1m0ua1:

1270998
d1m0ua1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1m0ua2